PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_021720-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 300aa    MW: 31993.5 Da    PI: 6.923
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_021720-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding34.25.8e-111255445
                     S-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  4 WTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwq 45
                     W+ e ++ + +a + ++ +   +W++Ia+ ++ g+tl ++k+++ 
    NNU_021720-RA 12 WSREQEKAFENALATHPEDsedRWEKIAADVP-GKTLSEIKHHYE 55
                     ********************************.**********96 PP

2Myb_DNA-binding40.46.9e-13121165347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT++E+ l++ +  ++G+g+W++I+r +   Rt+ q+ s+ qky
    NNU_021720-RA 121 AWTEDEHRLFLLGLDKYGKGDWRSISRNFVVSRTPTQVASHAQKY 165
                      6*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512939.439762IPR017884SANT domain
SMARTSM007179.8E-9860IPR001005SANT/Myb domain
SuperFamilySSF466895.67E-101064IPR009057Homeodomain-like
CDDcd001678.05E-91258No hitNo description
PfamPF002491.8E-81255IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.7E-51255IPR009057Homeodomain-like
PROSITE profilePS5129417.212113170IPR017930Myb domain
SuperFamilySSF466892.32E-16116171IPR009057Homeodomain-like
SMARTSM007175.5E-10118168IPR001005SANT/Myb domain
TIGRFAMsTIGR015572.1E-17118168IPR006447Myb domain, plants
CDDcd001671.89E-9121166No hitNo description
PfamPF002491.2E-10121165IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-10121164IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MTTDETGDSS LWSREQEKAF ENALATHPED SEDRWEKIAA DVPGKTLSEI KHHYELLVED  60
INGIESGRVP LPCYVSSEGS MDYASEAGAA KKGGNFGNFQ NDSSHGVKTQ RSDQERRKGI  120
AWTEDEHRLF LLGLDKYGKG DWRSISRNFV VSRTPTQVAS HAQKYFIRLN SMNKDRRRAS  180
IHDITSVGNG DIAAPQGPIT GQNSAPSTGA STGKSNKQSP QPQPGAPGVG VYGTTTIGQP  240
IGGPLISAVG TPVNLPAPAH MAYGVQPPVH GSVVPGAPMN VAPMTYPMPH ASAHSAVSSL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A4e-18781680RADIALIS
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00500DAPTransfer from AT5G08520Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010279472.10.0PREDICTED: transcription factor DIVARICATA
RefseqXP_010279473.10.0PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H71e-61DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A0L9UU291e-162A0A0L9UU29_PHAAN; Uncharacterized protein
STRINGGLYMA07G28310.11e-159(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08520.11e-114MYB family protein